The Job of your request has been done:
 | | Job ID: 20240429115835 |
| | Job Title: cdl1 |
| | Organism: S.cerevisiae |
| | Sequence Length: 240 Amino Acids |
| | Status: Done |
| | | Your Query Sequence:
MGWIPCSGYSGTKNKVEKMEAQDSLVGQIKATTGKLKRNSSTKSKDTSKNGNPDHIAAQTFSFRELATATRNFRAECLLG
EGGFGRVYKGRLESINQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGCLEDHLH
DIPPGKKQLDWNTRMKIAAGAAKGLEYLHDKANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGENTHVSTRVMGT |
The Detailed result:
The text format
===============================================================
Legend:
| Label | Score Range | Sensitivity | Specificity | |
| Low | [0.052 - 0.130] | 52.5% | 90% |
|
| High | (0.130 - ) | 31.2%; | 98% |
Note:
Only the score > 0.052 (i.e. specificity >= 90% ) is considered to be a positive prediction. Score range [0.052 - 0.130] corresponds to a low confidence prediction, while the prediction with a score > 0.130 should be regarded as high confidence (i.e. specificity > 98%).
Since the dataset we used was selected from the proteome of S. cerevisiae, the application of CKSAAP_UbSite should be favorable in the proteome of S. cerevisiae.